lever.co

🖥 Status: up
🕒 Response Time: 0.317 sec
⬅️ Response Code: 200
lever.co

36 availability checks of lever.co had over the 1 996 day period starting from February 24, 2021. Lever.co was available 36 times from the aggregate checks conducted, with the latest recorded uptime on July 7, 2026, returning a code 200. No downtime occurrences were observed for lever.co during inspections conducted as of August 14, 2026. No response had an error status, according to the replies that were received as of August 14, 2026. Lever.co showed a response time of 0.317 seconds on July 7, 2026, contrasting the average of 1.023 seconds.

3.0
36
Last Updated: July 7, 2026

Lever overview

Domain
lever.co
Title
Lever | Flexible Recruiting Software for Today's Hiring Teams
Description
Find, nurture, and hire the best talent easily and efficiently with Lever’s powerful recruiting software. Elevate your hiring results and book a demo today.
Main Topic
Recruitment Software for Dynamic Hiring Teams
R Site Status Rank
1 790
Search Wikipedia
lever.co
Alternatives
alternatives to lever.co
Recently checked
watchmygirlfriend.tv

trulia.com

Last Updated: July 25, 2026
Status: error
Response Time: 0.288 sec
Response Code: 403

habseyesontheprize.com

Last Updated: May 29, 2026
Status: up
Response Time: 1.088 sec
Response Code: 200

theminiaturespage.com

Last Updated: July 7, 2026
Status: up
Response Time: 0.602 sec
Response Code: 200

verifika.com

Last Updated: June 29, 2026
Status: down
Response Time: — sec
Response Code:

fuzionproductions.com

Last Updated: April 22, 2026
Status: error
Response Time: 0.338 sec
Response Code: 404

rezexpert.com

Last Updated: June 1, 2026
Status: error
Response Time: 0.120 sec
Response Code: 403

bidrl.com

Last Updated: July 2, 2026
Status: up
Response Time: 1.888 sec
Response Code: 200

Lever.co
status check request map as of August 14, 2026

lever.co request, July 7, 2026

Country report for lever.co as of August 14, 2026

United States 100.00%
19:29
SiteTotal ChecksLast Modified
thumbtack.comthumbtack.com33January 28, 2021
watchmygirlfriend.tvwatchmygirlfriend.tv68November 19, 2020
lever.colever.co36February 24, 2021
game-game.com.uagame-game.com.ua59January 18, 2021
dstv.comdstv.com41January 28, 2021

Bidrl.com

Lever.co

General SEO Report

Page TitlePage Title tips for lever.co: To maintain top-level SEO health, review your entire website's title structure: check character counts carefully, consider keyword placement, ensure descriptive clarity for named services, and always align message intent with user query expectations. Search Engine Optimization (SEO) is driven by ranking factors.
Lever | Flexible Recruiting Software for Today's Hiring Teams

Length: 66 characters
Meta DescriptionMeta Description tips for lever.co: Don't let search engines generate potentially misleading summaries for your content; write a clear, concise (under 160 characters) meta description that incorporates your primary keyword and accurately describes what users will find on your page.
Find, nurture, and hire the best talent easily and efficiently with Lever’s powerful recruiting software. Elevate your hiring results and book a demo today.

Length: 162 characters
Meta KeywordsMeta Keywords tips for lever.co: Integrate your target keywords naturally into the surrounding text on your webpage, ensuring a good user experience; this organic integration is far more impactful for rankings than stuffing a meta keywords tag.
no meta keywords data for lever.co
2026-08-14T03:35:40+00:00
Page ContentPage Content tips for lever.co: Design page content that incorporates both breadth and depth, covering related sub-topics thoroughly while maintaining a clear focus on the primary subject matter to avoid content dilution.
Web Page Content Length: 94098 characters
H1 HeadingH1 Heading tips for lever.co: Choosing H1 tags that include relevant, high-intent keywords naturally woven into compelling copy significantly boosts SEO visibility and aligns content structure with user search intent.
Recruitment Software for Dynamic Hiring Teams

Count: 1 heading tag
H2 HeadingsH2 Headings tips for lever.co: Deeper analysis of your website's architecture reveals H2 tags contribute significantly to internal linking opportunities, powerfully informing page authority metrics across the site.
Whatever Comes Next, Lever Moves With You
Why Lever?
Recognized by the Best in the Biz
Praised by the People Who Matter Most
Discover the Employ Advantage with Our AI Companions by Your Side
Real Options. Real Flexibility. For All the Ways You Hire.
Ready to Power Your Hiring Momentum?
Lever Talent Acquisition Software FAQs: Your Questions Answered
What is Lever and how does it support modern recruiting?
How does Lever’s applicant tracking system work?
Does Lever include AI Companion or recruitment automation tools or automation tools?
What integrations does Lever support?
How does Lever compare to other applicant tracking systems like Greenhouse, Workable, or Ashby?


Count: 13 heading tag
H3 HeadingsH3 Headings tips for lever.co: Integrate H3 headers directly into your internal linking strategy by linking to relevant subpages or resources mentioned under specific section headers, distributing page authority strategically and improving navigation pathways.
Tour Our Award-Winning Recruitment Software
See it in Action!
Integrated AI-Powered Interview Tool
Recruiting Realities: What’s Shaping TA Today
ROI That Shakes The Walls
The True AI Revolution in Talent Acquisition


Count: 6 heading tag
H4 HeadingsH4 Headings tips for lever.co: Incorporating H4 tags for internal linking strategies allows for targeted anchor text placement around specific sub-topics, guiding users to related content and distributing link equity effectively across the site architecture for improved navigation and SEO.
no h4 headings data for lever.co
2026-08-14T03:35:40+00:00
H5-H6 HeadingsH5-H6 Headings tips for lever.co: Using H5-H6 headers appropriately in FAQ sections allows for concise categorization of questions and provides semantic cues to crawlers about the FAQ content's importance within the page.
no h5-h6 headings data for lever.co
2026-08-14T03:35:40+00:00
Image ALT AttributesImage ALT Attributes tips for lever.co: Alt attributes serve a dual purpose in web development, acting as essential tools for making image content accessible to visually impaired users while simultaneously improving your site's ranking potential with search engines.
https://www.lever.co/wp-content/uploads/2022/09/Lever_Employ_Logo_Horizontal_Turquoise_Black.png
https://www.lever.co/wp-content/uploads/2023/02/Interview.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Marketing.png
https://www.lever.co/wp-content/uploads/2023/02/High-Volume-Hiring.png
https://www.lever.co/wp-content/uploads/2023/02/Diversity-and-Inclusion.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Automation.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Analytics.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Communication.png
https://www.lever.co/wp-content/uploads/2023/02/Career-Site-Builder.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Add-Ons.png
and 16 more...


Count: 11 images with ALT attributes
Robots.txtRobots.txt tips for lever.co: Use the robots.txt file strategically to block access to private or non-public areas of your website (like admin panels, staging environments, or password-protected sections) to prevent unauthorized access and potential indexing of unintended content
file robots.txt was found on the website
XML SitemapXML Sitemap tips for lever.co: An XML sitemap submission complements your internal linking strategy by providing an external reference point for search engines, making it easier for bots to navigate complex site architectures and understand page relationships
no xml sitemap data for lever.co
2026-08-14T03:35:40+00:00
Page SizePage Size tips for lever.co: Mobile users expect instant gratification; a compact page size ensures swift loading on cell networks, preventing impatient clicks away from your site and protecting mobile SEO.
page size: 92 kb
Response TimeResponse Time tips for lever.co: Regularly monitoring your website's response time using tools like Google PageSpeed Insights or Web Vitals reports allows you to identify and rectify performance bottlenecks promptly, ensuring sustained site speed.
response time: 1.023 sec
Minify CSSMinify CSS tips for lever.co: Be astute, website developer: options discussions within your CSS build tools often include aggressive compression settings that excise even potential buffering blocks introduced earlier; moderate minification perfectly balances file size gain with safe delivery.
Minified:
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/genesis-blocks/dist/style-blocks.build.css?ver=1761151307
https://www.lever.co/wp-includes/blocks/navigation/style.min.css?ver=6.8.3
https://www.lever.co/wp-includes/blocks/image/style.min.css?ver=6.8.3
https://www.lever.co/wp-includes/blocks/cover/style.min.css?ver=6.8.3
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/metronet-profile-picture/dist/blocks.style.build.css?ver=1761151307
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/accordion-blocks/build/index.css?ver=1761151308
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/fse-pro/assets/css/style.css?ver=1761151308
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-includes/css/dashicons.min.css?ver=1761151310
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/uploads/fonts/d1c78dae9dce76adcc981689089c3929/font.css?ver=1761151309
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/catch-fse/style.css?ver=1761151309
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/theme.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/kuya.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/custom-style.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/custom-lev-3mw.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/catch-fse/style.css?ver=1761151309


included in the page
Minify JavaScriptMinify JavaScript tips for lever.co: Consider implementing server-side JavaScript minification to serve already compressed code to users, drastically cutting load times and improving page speed, which is a fundamental aspect of good SEO practice.
Minified:
https://www.lever.co/wp-content/plugins/nelio-ab-testing/assets/dist/js/visitor-type.js?ver=fed1bd0d2f7778dac059
https://www.lever.co/wp-includes/js/jquery/jquery.min.js?ver=3.7.1
https://www.lever.co/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.4.1
https://plausible.io/js/script.tagged-events.js
//659-JST-226.mktoweb.com/js/forms2/js/forms2.min.js
https://www.lever.co/wp-content/plugins/accordion-blocks/js/accordion-blocks.min.js?ver=1.5.0
https://www.lever.co/wp-content/plugins/wp-rocket/assets/js/lazyload/17.8.3/lazyload.min.js


detected during site scan
Structured DataStructured Data tips for lever.co: Employing schema for recipes allows you to showcase cooking details, estimated nutrition information, and aggregated user ratings, making your culinary content incredibly visible in search results and appealing to recipe-driven user intent.
no structured data data for lever.co
2026-08-14T03:35:40+00:00
CDN UsageCDN Usage tips for lever.co: By strategically caching frequently accessed data such as user session cookies or authentication tokens closer to the user within a CDN, you can significantly reduce the load on your origin servers, enhancing overall website responsiveness.
content is delivered via CDN
SSL certificatesSSL certificates tips for lever.co: Utilizing SSL/TLS encryption is crucial not only for safeguarding sensitive user information against interception and tampering but also for enhancing your website's credibility, as browser indicators like the padlock icon signal a secure connection to visitors.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:149 056
Minimum Daily Visits:174 198
Minimum Daily Page Views:299 909
Minimum Monthly Unique Visitors:4 471 680
Minimum Monthly Visits:5 225 940
Minimum Monthly Page Views:8 997 270
Minimum Yearly Unique Visitors:53 660 160
Minimum Yearly Visits:62 711 280
Minimum Yearly Page Views:107 967 240
Maximum Daily Unique Visitors:188 565
Maximum Daily Visits:201 136
Maximum Daily Page Views:339 418
Maximum Monthly Unique Visitors:5 656 950
Maximum Monthly Visits:6 034 080
Maximum Monthly Page Views:10 182 540
Maximum Yearly Unique Visitors:67 883 400
Maximum Yearly Visits:72 408 960
Maximum Yearly Page Views:122 190 480

Estimated Valuation

Daily Revenue:US$ 216 - 485
Monthly Revenue:US$ 6 480 - 14 550
Yearly Revenue:US$ 77 760 - 174 600

Estimated Worth

Minimum:US$ 116 640
Maximum:US$ 523 800

Similarly Ranked Sites

RankPoints
r2games.comr2games.com5 4044 639 669
fuskator.comfuskator.com5 4054 639 669
questionablecontent.netquestionablecontent.net5 4064 639 668
thumbtack.comthumbtack.com5 4074 639 668
watchmygirlfriend.tvwatchmygirlfriend.tv5 4084 639 668
lever.colever.co5 4094 639 667
game-game.com.uagame-game.com.ua5 4104 639 667
dstv.comdstv.com5 4114 639 667
redlink.com.arredlink.com.ar5 4124 639 666
boyfriendtv.comboyfriendtv.com5 4134 639 666
hatenadiary.jphatenadiary.jp5 4144 639 666